- Search results for GeneID 945190
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
2 products were found matching "GeneID 945190"!
Close filters
Filter by:
No results were found for the filter!
Item number: 375116.100
Source:, Recombinant protein corresponding to aa2-85 from E. coli 50S Ribosomal Protein L27, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~36.0kD, AA Sequence: AHKKAGGSTRNGRDSEAKRLGVKRFGGESVLAGSIIVRQRGTKFHAGANVGCGRDHTLFAKADGKVKFEVKGPKNRKFISIEAE, Storage and Stability: May be stored at 4°C...
Keywords: | rpmA, b3185, 50S ribosomal protein L27, Large ribosomal subunit protein bL27 |
MW: | 36 |
From 636.00€
*
Item number: 375117.100
Source:, Recombinant protein corresponding to aa2-85 from E. coli 50S Ribosomal Protein L27, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~13kD, AA Sequence: AHKKAGGSTRNGRDSEAKRLGVKRFGGESVLAGSIIVRQRGTKFHAGANVGCGRDHTLFAKADGKVKFEVKGPKNRKFISIEAE, Storage and Stability: May be stored at 4°C...
Keywords: | rpmA, b3185, 50S ribosomal protein L27, Large ribosomal subunit protein bL27 |
MW: | 13 |
From 636.00€
*